PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.N03107.1.p
Common NameLOC105959533, MIMGU_mgv1a013539mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family FAR1
Protein Properties Length: 218aa    MW: 24708 Da    PI: 9.0819
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.N03107.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR161.32.9e-1951136290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       +Y++YA ++GF +r+ +s+ks+r+g+i++r + C +  ++++  +    +++  ++ r gC+a+l +k+e+ g+w+v k++ +HnH+l+
  Migut.N03107.1.p  51 YYDNYAGRAGFLTRVLSSRKSERDGSIISRGLGCRNILNAQKACNI---SNEVGEKRRDGCTAMLLIKRENGGRWVVRKFVRDHNHPLV 136
                       8*********************************887666665444...6778888999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.2E-1751136IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MDMEDALDRG NGMIEASVVG EVTSYQADIN IENTEPYEGM TFESDSAARA YYDNYAGRAG  60
FLTRVLSSRK SERDGSIISR GLGCRNILNA QKACNISNEV GEKRRDGCTA MLLIKRENGG  120
RWVVRKFVRD HNHPLVASLP KRRPTYDEKD KRIQELTAEL RIKKRLSAAY REQLLILMKD  180
VDSHNDHLTS KVQIIRNNLK ELEATRQELS LHNKPSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839104.11e-161PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X2
RefseqXP_012839105.11e-161PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X3
TrEMBLA0A022RAG61e-161A0A022RAG6_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000694932e-98(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.12e-55FAR1 family protein